PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000248333
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 764aa    MW: 82259 Da    PI: 7.7746
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000248333genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.77e-101254444
                     S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                     WT e d+ + +a + ++     +W++Ia+ ++ g+tl+++k+++
    MDP0000248333 12 WTREQDKSFENALATYPEXssdRWEKIAADVQ-GKTLEEIKHHY 54
                     *****************99*************.**********9 PP

2Myb_DNA-binding24.85e-081621981147
                      HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      l++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
    MDP0000248333 162 LFLLGLEKYGKGDWRSISRNFVVTRTPTQVASHAQKY 198
                      678899******************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.9E-7860IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-41059IPR009057Homeodomain-like
SuperFamilySSF466894.19E-101065IPR009057Homeodomain-like
CDDcd001671.49E-71258No hitNo description
PROSITE profilePS500906.9221258IPR017877Myb-like domain
PfamPF002493.4E-71254IPR001005SANT/Myb domain
PROSITE profilePS512949.383147203IPR017930Myb domain
SMARTSM007170.34151201IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.9E-11160201IPR006447Myb domain, plants
SuperFamilySSF466894.79E-10160204IPR009057Homeodomain-like
CDDcd001672.63E-5161199No hitNo description
Gene3DG3DSA:1.10.10.601.1E-5162197IPR009057Homeodomain-like
PfamPF002495.1E-6162198IPR001005SANT/Myb domain
Gene3DG3DSA:3.40.1390.102.2E-10349415IPR000713Mur ligase, N-terminal catalytic domain
SuperFamilySSF634181.83E-8350445IPR000713Mur ligase, N-terminal catalytic domain
TIGRFAMsTIGR011438.4E-95374755IPR005863UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
Gene3DG3DSA:3.40.1190.109.6E-55430661IPR013221Mur ligase, central
SuperFamilySSF536232.35E-41450662IPR013221Mur ligase, central
PfamPF082458.5E-31453644IPR013221Mur ligase, central
Gene3DG3DSA:3.90.190.206.1E-24663755IPR004101Mur ligase, C-terminal
SuperFamilySSF532442.98E-21664754IPR004101Mur ligase, C-terminal
PfamPF028751.4E-9665730IPR004101Mur ligase, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009058Biological Processbiosynthetic process
GO:0071555Biological Processcell wall organization
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0005524Molecular FunctionATP binding
GO:0047480Molecular FunctionUDP-N-acetylmuramoyl-tripeptide-D-alanyl-D-alanine ligase activity
Sequence ? help Back to Top
Protein Sequence    Length: 764 aa     Download sequence    Send to blast
MTVEEVVSSS LWTREQDKSF ENALATYPEX SSDRWEKIAA DVQGKTLEEI KHHYDLLLED  60
LTQIEAGVVP LPCYNSSSEG STSHASDEGT NKKGGHSGNY SSESNHGSKA SRADQERRKG  120
IAWTEDEHRR NLNEMEIVEV ATLLQKLEEV RLSPLKMDIR RLFLLGLEKY GKGDWRSISR  180
NFVVTRTPTQ VASHAQKYFI RLNSMNKDXR RSSIHDITSV NNGEISAAQG PITGQANGAA  240
XGSSGKSPKQ SPAGPPGVGM YGAPSIGQPI GGPLVSAVGT PVNLPAPPHM AYGVRAPVPG  300
GVVPGAPMNM VPMTYPMPHS SHRHSISIAT KXSINPSSPN PPESESKTLW TVSDIAAAVN  360
GRXVKWGPPG TXSTDTRTLX PNQWFFAIAG PNFDAHDFVX PELSRRGCAG VIGNRVCENW  420
DRGFVECXGN TVVSLKKMAS YARNRFHGEV VGVTGSVGKT STKSMIALAL ESSTCLVHQS  480
HGNWNNEIGV ALSLIGMPRN SGVVVLEMGM SGKGEILELA RTARPTVRLI LNVGASHFCN  540
FSSLEEIAIA KGEILAEAKP GDVCVLNADD PLVMSLPVPY GVKKVLFGRR RTVGCHVRLV  600
VSESTNRGLG VRVVLQNHQE MVEFVIPSPG VHLGVNACAA AAVATLLGXS LSQIGVRLSA  660
FSPVHMRLEL EIARNGTKIV NDAYNANPVS TKAAIDVLES IDCRGKRIAI LGDMLELGGI  720
EMESHEMILK QCRSARIDLV GLVGERFCAA AASMKSLDEM NIXY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2am2_A3e-3637575132394UDP-N-acetylmuramoylalanine-D-glutamyl-lysine
2am1_A3e-3637575132394UDP-N-acetylmuramoylalanine-D-glutamyl-lysine
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.106760.0bud| leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008367048.10.0PREDICTED: uncharacterized protein LOC103430675
TrEMBLM5Y7130.0M5Y713_PRUPE; Uncharacterized protein (Fragment)
STRINGVIT_10s0071g00610.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-99MYB family protein